PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00108.1_g00072.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 352aa    MW: 40246.4 Da    PI: 6.3561
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00108.1_g00072.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.2e-191461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT eEd++lvd+++q+G g+W+t ++  g+ R++k+c++rw +yl
  Rsa1.0_00108.1_g00072.1 14 KGPWTSEEDKKLVDYIQQHGYGNWRTLPQNAGLQRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding52.11.5e-1667111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  Rsa1.0_00108.1_g00072.1  67 RGRFSLEEEETIIHLHSFLGNK-WSAIAARLP-GRTDNEIKNFWNTH 111
                              89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129416.174961IPR017930Myb domain
SuperFamilySSF466891.1E-3011108IPR009057Homeodomain-like
SMARTSM007172.6E-121363IPR001005SANT/Myb domain
PfamPF002496.5E-161461IPR001005SANT/Myb domain
CDDcd001671.40E-111661No hitNo description
PROSITE profilePS5129424.45562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.0E-2665116IPR009057Homeodomain-like
SMARTSM007174.9E-1566114IPR001005SANT/Myb domain
PfamPF002497.9E-1567111IPR001005SANT/Myb domain
CDDcd001673.74E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGRSPCCEKT GLKKGPWTSE EDKKLVDYIQ QHGYGNWRTL PQNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SLEEEETIIH LHSFLGNKWS AIAARLPGRT DNEIKNFWNT HIRKKLLRMG  120
IDPVTHSPRL DLLDISSILA SSLCNSSSHH VNMSRLMMDT HRQQQQHSLV NPEILKLATS  180
LFSQNQTQNH NQNQNFVVDH DTNNQEHHSV YHQDVNEAGV NQYQTDHQDY QSCMPPFPNE  240
AQFNDMGHQF NIFGEQNLAS TSNTSVQDCN IPSFNDYANS GFVLDPSYSD KSFSFANSVL  300
NTPSSSPTTL HSSSTTYINS SSYNTEDEIE SYCSNLMKFD IPDFLDVNDF LI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013583582.10.0PREDICTED: transcription factor MYB39
TrEMBLA0A078JE850.0A0A078JE85_BRANA; BnaC01g41180D protein
STRINGBra013526.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-171MYB-like 102